Loading...
Statistics
Advertisement

Atlas.Social · Hotspot 2.0
www.atlas.social/

Atlas.social

Advertisement
Conversion Technology Metas Server
Atlas.social is hosted in Turkey . Atlas.social uses HTTPS protocol. Number of used technologies: 7. First technologies: Carousel, CSS, Font Awesome, Number of used javascripts: 7. First javascripts: Jquery-1.10.2.min.js, Bootstrap.min.js, Jquery.timeago.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/8.0.

Technologies in use by Atlas.social

Technology

Number of occurences: 7
  • Carousel
  • CSS
  • Font Awesome
  • Google Font API
  • Html
  • Html5
  • Iframe

Advertisement

Javascripts

Number of occurences: 7
  • jquery-1.10.2.min.js
  • bootstrap.min.js
  • jquery.timeago.js
  • tweetable.jquery.min.js
  • jquery.carouFredSel-6.2.1-packed.js
  • mvpready-core.js
  • mvpready-landing.js

Server Type

  • Microsoft-IIS/8.0

Powered by

  • ASP.NET

CDN

Number of occurences: 2
  • Maxcdn
  • OSS CDN

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Atlas.social

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Wildcard/CN=*.markum.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Wildcard
      • CN: *.markum.net
    • hash: f77924f5
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 223262643322582486748768387534808740387
    • validFrom: 160414000000Z
    • validTo: 170427235959Z
    • validFrom_time_t: 1460592000
    • validTo_time_t: 1493337599
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: C7:D4:88:4B:45:38:3E:65:C7:05:D8:A8:59:F3:4D:68:69:F9:C3:B3
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.markum.net, DNS:markum.net

Meta - Atlas.social

Number of occurences: 4
  • Name:
    Content:
  • Name: viewport
    Content: width=device-width, initial-scale=1.0
  • Name: description
    Content:
  • Name: author
    Content:

Server / Hosting

  • IP: 213.14.121.189
  • Latitude: 41.02
  • Longitude: 28.99
  • Country: Turkey

Rname

  • dns1.yandex.net.atlas.social
  • dns2.yandex.net.atlas.social
  • mx.yandex.net

Target

  • destek.markum.net

HTTP Header Response

HTTP/1.1 200 OK Cache-Control: private Content-Length: 6602 Content-Type: text/html; charset=utf-8 Server: Microsoft-IIS/8.0 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Mon, 09 May 2016 20:33:08 GMT X-Cache: MISS from s_xt13 X-Cache-Lookup: MISS from s_xt13:80 Via: 1.1 s_xt13 (squid/3.5.13) Connection: keep-alive

DNS

host: atlas.social
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 178.210.173.10
host: atlas.social
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns1.yandex.net.atlas.social
host: atlas.social
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns2.yandex.net.atlas.social
host: atlas.social
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: dns1.markum.net
  5. rname: destek.markum.net
  6. serial: 2015102503
  7. refresh: 3600
  8. retry: 600
  9. expire: 1209600
  10. minimum-ttl: 86400
host: atlas.social
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: mx.yandex.net
host: atlas.social
  1. class: IN
  2. ttl: 86400
  3. type: TXT
  4. txt: v=spf1 redirect=_spf.yandex.net
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.tlas.social, www.aotlas.social, www.otlas.social, www.aptlas.social, www.ptlas.social, www.a9tlas.social, www.9tlas.social, www.atlas.social, www.tlas.social, www.aitlas.social, www.itlas.social, www.autlas.social, www.utlas.social, www.alas.social, www.atqlas.social, www.aqlas.social, www.atalas.social, www.aalas.social, www.at las.social, www.a las.social, www.atwlas.social, www.awlas.social, www.atelas.social, www.aelas.social, www.atzlas.social, www.azlas.social, www.atxlas.social, www.axlas.social, www.atclas.social, www.aclas.social, www.atas.social, www.atluas.social, www.atuas.social, www.atl8as.social, www.at8as.social, www.atl9as.social, www.at9as.social, www.atljas.social, www.atjas.social, www.atl0as.social, www.at0as.social, www.atlmas.social, www.atmas.social, www.atlpas.social, www.atpas.social, www.atloas.social, www.atoas.social, www.atls.social, www.atlaos.social, www.atlos.social, www.atlaps.social, www.atlps.social, www.atla9s.social, www.atl9s.social, www.atlas.social, www.atls.social, www.atlais.social, www.atlis.social, www.atlaus.social, www.atlus.social, www.atla.social, www.atlase.social, www.atlae.social, www.atlasw.social, www.atlaw.social, www.atlasd.social, www.atlad.social, www.atlasx.social, www.atlax.social, www.atlasf.social, www.atlaf.social, www.atlasg.social, www.atlag.social, www.atlast.social, www.atlat.social,

Other websites we recently analyzed

  1. Ãœber uns | cairos-academy
    Germany - 78.47.220.105
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  2. miscmannamagalginknimatnyasvetchargapoleaz
    San Francisco (United States) - 192.0.78.13
    Server software: nginx
    Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
    Number of Javascript: 8
    Number of meta tags: 7
  3. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
    Kansas City (United States) - 173.208.215.148
    Server software: Microsoft-IIS/6.0
    Technology: Html
    Number of meta tags: 1
  4. Restaurant La Ripaille
    Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
    France - 213.186.33.104
    G Analytics ID: UA-441859-8
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 4
  5. Tennessee Career Centers
    Columbia (United States) - 66.211.30.3
    G Analytics ID: UA-39861102-1
    Server software:
    Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
    Number of Javascript: 4
    Number of meta tags: 1
  6. Home | Instant Spark
    Scottsdale (United States) - 173.201.243.1
    Server software: Apache
    Technology: Html
  7. Die Potsdam Lions
    Germany - 212.90.148.98
    Server software: Apache/2.2.31
    Technology: Html, Php
    Number of meta tags: 1
  8. Dorcas Clothing :: Wholesale Clothing
    Dorcas is a fashion wholesaler specializing in women's apparel located in Los Angeles fashion district. We offer the latest fashion at the best quality and price.
    Montréal (Canada) - 184.107.203.99
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI, Lightbox, Php
    Number of Javascript: 10
    Number of meta tags: 10
  9. THE NEW MILLIONS
    New York (United States) - 198.185.159.145
    Server software:
    Technology: CSS, Html, Iframe, Javascript, Lightbox, Php, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  10. ماشین های اداری امیران
    امیران ماشین
    Iran, Islamic Republic of - 185.8.172.176
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 3

Check Other Websites